DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:107 Identity:37/107 - (34%)
Similarity:55/107 - (51%) Gaps:16/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFLIVFVALFAVALAAPA--AEEPTI---VRS-ESDVGPES--FKYDWETSDGQAAQAVGQLNDI 58
            |..:|.:...:|.|...|  ::.|..   :|| .:::..|.  :.|.:|||:|.|.|..|    :
  Fly     3 KINVVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG----V 63

  Fly    59 GTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLP 100
            |    ....|||.::...:||..|:.|.||:|||||||.|||
  Fly    64 G----GYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:459790 19/54 (35%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.