DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:80 Identity:32/80 - (40%)
Similarity:52/80 - (65%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IVRSESDVGPE-SFKYDWETSDGQAAQAVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIAD 88
            |::...|:.|: |::|::|||:|..|...|.|.:.|::.||..:.|||.:...||..|.:.||||
  Fly    43 ILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTITYIAD 107

  Fly    89 KNGFQPQGAHLPVAP 103
            :||::.:|||:|..|
  Fly   108 ENGYRAEGAHIPTPP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:306811 22/54 (41%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.