DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag2 and Lcp2

DIOPT Version :9

Sequence 1:NP_477272.1 Gene:Lcp65Ag2 / 38702 FlyBaseID:FBgn0020637 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001260802.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster


Alignment Length:106 Identity:29/106 - (27%)
Similarity:52/106 - (49%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFLIVFVALFAVALAAPAAEEPTI---VRSES-DVGPESFKYDWETSDGQAAQAVGQLNDIGTEN 62
            ||:::...:......||.:....:   |.|.| ||..:.|.....||:|....|.|..:.     
  Fly     3 KFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRADGFDSSLHTSNGIEQAASGDAHG----- 62

  Fly    63 EAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAP 103
               ::.|::.:|:.:|:..:|.|:|::||:||.||.:|..|
  Fly    63 ---NIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag2NP_477272.1 Chitin_bind_4 37..92 CDD:306811 13/54 (24%)
Lcp2NP_001260802.1 Chitin_bind_4 42..89 CDD:278791 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.