DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbn and CG8927

DIOPT Version :9

Sequence 1:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:290 Identity:56/290 - (19%)
Similarity:89/290 - (30%) Gaps:94/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CSGCFLKKS---PPKTEIRTLSQPLAPVQPGKPDGSSDIGLNVQLPFRESIAQTVASRLGLLQDT 186
            ||...|.::   ||:     ||.|.|...||            |:|.|:.:.:.......|.|. 
  Fly    10 CSAIALTEAQNYPPR-----LSIPGAVASPG------------QVPHRQPVLRVRRPGASLRQQ- 56

  Fly   187 LQTSNTNTNAPNTKTIELGLNIAMSTYYTTKNAVTGHVSTQTSNSQTPSANTKIDYNVGVVEKAS 251
                  ||..|                     |||..::.:.....|.||           |...
  Fly    57 ------NTILP---------------------AVTQRIAIEEPRPVTESA-----------EDEQ 83

  Fly   252 PPVYRPLNIRLNEDVMRQAITYGNTIPGHVPLPNQPLVETSLLPASQVKIFALDGNAKVPLASNI 316
            |..|.|       :::|:                |.|.:.......|.....|.|...|...|.:
  Fly    84 PEPYLP-------NLLRE----------------QQLAQAQQSQFQQAAAAFLAGQQPVEQPSPV 125

  Fly   317 QSVAQHPNAGLNAKVPLASNIQSVAQHPNAGLNAKVPLASNIQSVAQHPNAGLKNINRSGVSSA- 380
            |...|..::...|.:|..|: :..|:.|:.......|.|.|...:.:..|:....:.|...::| 
  Fly   126 QQFLQSDDSQPAAILPPPSS-RFPAERPSIPTPLNRPAAFNDFGIGRFENSQRFGLERPTPTAAA 189

  Fly   381 --------KTLANTKTRPPHT--FNPHQTP 400
                    :.:|..:|||..:  ..|...|
  Fly   190 PPPPQQQPQRVAVIRTRPASSAALRPESPP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbnNP_729143.2 Chitin_bind_4 31..77 CDD:278791
Chitin_bind_4 575..621 CDD:278791
CG8927NP_650527.2 Chitin_bind_4 276..336 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.