powered by:
Protein Alignment l(3)mbn and Cpr47Ec
DIOPT Version :9
Sequence 1: | NP_729143.2 |
Gene: | l(3)mbn / 38701 |
FlyBaseID: | FBgn0002440 |
Length: | 653 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610657.1 |
Gene: | Cpr47Ec / 36191 |
FlyBaseID: | FBgn0033600 |
Length: | 131 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 19/73 - (26%) |
Similarity: | 30/73 - (41%) |
Gaps: | 14/73 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 554 SGFGGEIGSGRGSASSATGDLYKFKYILDYNGHEETGGRNGDKQGSYFAIGEDAVQRTIEYIANE 618
|.:.|..|..|...: :::|....||. .:.:|||..|.||..:..:.|.|.:
Fly 45 SAYVGADGISRNEEA----------FLVDKGTDEEA----LEVKGSYKYINEDGQEVEVFYTAGK 95
Fly 619 FGFQPHVS 626
.||.|:.|
Fly 96 NGFVPYGS 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.