DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(3)mbn and Pcp

DIOPT Version :9

Sequence 1:	NP_729143.2	Gene:	l(3)mbn / 38701	FlyBaseID:	FBgn0002440	Length:	653	Species:	Drosophila melanogaster
Sequence 2:	NP_476673.1	Gene:	Pcp / 33985	FlyBaseID:	FBgn0003046	Length:	184	Species:	Drosophila melanogaster

Alignment Length:	69	Identity:	18/69 - (26%)
Similarity:	31/69 - (44%)	Gaps:	9/69 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   547 GITGTKASGFGGEIGSGRGSASSATGDLYKFKYILDYNGHEETGGRNGDKQGSYFAIGEDAVQRT 611
            ||:.:: .|.||....|..|.:|..|::....|:.|..|:...        |::.....|.:.|:
  Fly    54 GISASQ-EGLGGVAVQGGSSYTSPEGEVISVNYVADEFGYHPV--------GAHIPQVPDYILRS 109

  Fly   612 IEYI 615
            :|||
  Fly   110 LEYI 113

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(3)mbn	NP_729143.2	Chitin_bind_4	31..77	CDD:278791
l(3)mbn	NP_729143.2	Chitin_bind_4	575..621	CDD:278791	9/41 (22%)
Pcp	NP_476673.1	Chitin_bind_4	45..92	CDD:278791	11/38 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR10380
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100