DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and fev

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001315078.1 Gene:fev / 791175 ZFINID:ZDB-GENE-070112-1852 Length:235 Species:Danio rerio


Alignment Length:233 Identity:118/233 - (50%)
Similarity:143/233 - (61%) Gaps:38/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 GGSALYSSYKSSWGSHSSTQSQGYSSNALGIKHDPHSQLRQPDPYQMFGPTSSRLASSGSGQIQL 319
            |||.:::.|.|                      ||...|.:......:.|.::.: ..|||||||
Zfish    19 GGSLMFNMYLS----------------------DPTENLLKESKSPSWTPINTGV-QKGSGQIQL 60

  Fly   320 WQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM 384
            |||||||||||.|.:||.||||||||||.||||||||||||||||||||||||||||||||||||
Zfish    61 WQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM 125

  Fly   385 TKVHGKRYAYKFDFQGLAAATQPAASDPT-YKYQSDLFMTPYHHSAKLSSFMSPHHGMTSSSASI 448
            ||||||||||||||.|||...||::::.. ||:||:.....:...:|| :.::|  |:..|..|.
Zfish   126 TKVHGKRYAYKFDFNGLAQVCQPSSTEQAIYKFQSNFAPIQFSGISKL-NLVAP--GVGPSGFSY 187

  Fly   449 FPSAASWGNWGSPATNLYQPHSMSHVTP--SHVAPHLS 484
            :|        |||.| ||..|::....|  :..|.|||
Zfish   188 WP--------GSPPT-LYHSHNLQPPGPFGAVSASHLS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 78/84 (93%)
fevNP_001315078.1 ETS 57..142 CDD:197710 78/84 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1113327at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3711
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.