DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and elf1

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001072854.1 Gene:elf1 / 780315 XenbaseID:XB-GENE-492875 Length:632 Species:Xenopus tropicalis


Alignment Length:279 Identity:76/279 - (27%)
Similarity:108/279 - (38%) Gaps:68/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 HSSTQSQGYSSNALGIKHDPHSQ--------LRQPDPYQMFGPTSS------RLASSGSGQ-IQL 319
            |.:...:...||.       |.|        .|.|.|.   .||::      :....|.|. |.|
 Frog   152 HQNIYEENLESNL-------HEQPKRKKGRKPRNPRPE---SPTTTPNISVKKKNKDGKGNTIYL 206

  Fly   320 WQFLLELLSDSNNASC---ITW-EGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYD 380
            |:|||.||.|  .|:|   |.| :...|.|||.|...|:|.||:.|:||:|||:.:.|||||||.
 Frog   207 WEFLLALLQD--KATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQ 269

  Fly   381 KNIMTKVHGKRYAYKF----------DFQGLAAATQPAAS-DPTYKYQSDLFMTPYHHSAKLSSF 434
            :.|:.||.|:|..|:|          |.:..::..:.:.: ...:..|.....||..:.|:.|..
 Frog   270 RGILAKVEGQRLVYQFKEMPKDLVYIDEEDSSSGAEYSGNLSSEFSLQHSSVTTPTRNQARASKG 334

  Fly   435 MSPHHGMTSSS-----------------------ASIFPSAASWGNWGSPATNLYQPHSMSHVTP 476
            .|......||:                       .|:.||........||.|   |||.......
 Frog   335 SSNTASRASSATVLKNGSSKSLKLKEEIDTVQQQVSLLPSDLLRTIQASPVT---QPHPTQLYRT 396

  Fly   477 SHVAPHLSSYPHYAXPSSS 495
            .|:.....:.|..| ..|:
 Frog   397 VHLMQSGQAIPEQAITYST 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 43/99 (43%)
elf1NP_001072854.1 Elf-1_N 2..110 CDD:372034
ETS 203..285 CDD:197710 41/83 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.