DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and erf

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_005159421.1 Gene:erf / 560416 ZFINID:ZDB-GENE-010724-17 Length:621 Species:Danio rerio


Alignment Length:248 Identity:82/248 - (33%)
Similarity:107/248 - (43%) Gaps:64/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 ASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRA 374
            :|.||.|||||.|:||||........|.|:|..|||.:.|||||||.||.||.||.|||||||||
Zfish    20 SSPGSRQIQLWHFILELLRKEEYHDVIAWQGDYGEFVIKDPDEVARLWGARKCKPQMNYDKLSRA 84

  Fly   375 LRYYYDKNIMTKVHGKRYAYKFDF------------QGLAAATQPAASDPTYKYQSDLFMTPYHH 427
            |||||:|.|:.|..|||:.|||:|            .|.|.:..|.::.|.....|..|..|   
Zfish    85 LRYYYNKRILHKTKGKRFTYKFNFNKLVLVNYPFIDMGSAGSGVPQSAPPVPSGVSTHFRFP--- 146

  Fly   428 SAKLSSFMSPHHGM------------------------TSSSASIFPSAASWGN----------- 457
            .:..|..:||...:                        ||:::.:..:..:.|:           
Zfish   147 PSTPSDVLSPSEELRSPGVFSAVPRRIARGSVSDCSDGTSTNSELEETGMAPGDDRPADRAFRNL 211

  Fly   458 -------------WGSPATNLYQPHSMSHVTPSHVAPH-LSSYPHYAXPSSSG 496
                         :|:|......|.|..||.|..:.|. ||.:|....|...|
Zfish   212 LHPRLSHDSLFRVYGAPPNPTGLPRSGPHVPPHRMHPEPLSPFPVSPLPGPGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 53/96 (55%)
erfXP_005159421.1 ETS 26..111 CDD:197710 53/84 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.