Sequence 1: | NP_001303373.1 | Gene: | Ets65A / 38700 | FlyBaseID: | FBgn0005658 | Length: | 728 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005159421.1 | Gene: | erf / 560416 | ZFINID: | ZDB-GENE-010724-17 | Length: | 621 | Species: | Danio rerio |
Alignment Length: | 248 | Identity: | 82/248 - (33%) |
---|---|---|---|
Similarity: | 107/248 - (43%) | Gaps: | 64/248 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 ASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRA 374
Fly 375 LRYYYDKNIMTKVHGKRYAYKFDF------------QGLAAATQPAASDPTYKYQSDLFMTPYHH 427
Fly 428 SAKLSSFMSPHHGM------------------------TSSSASIFPSAASWGN----------- 457
Fly 458 -------------WGSPATNLYQPHSMSHVTPSHVAPH-LSSYPHYAXPSSSG 496 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets65A | NP_001303373.1 | ETS | 316..401 | CDD:197710 | 53/96 (55%) |
erf | XP_005159421.1 | ETS | 26..111 | CDD:197710 | 53/84 (63%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3806 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |