DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and Etv3l

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001382570.1 Gene:Etv3l / 499651 RGDID:1562620 Length:349 Species:Rattus norvegicus


Alignment Length:290 Identity:93/290 - (32%)
Similarity:108/290 - (37%) Gaps:102/290 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 ASSGSGQIQLWQFLLELLSDSNNASCITW-EGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSR 373
            :|.||.|||||.|:||||........|.| :|..|||.:.|||||||.||.||.||.||||||||
  Rat    64 SSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSR 128

  Fly   374 ALRYYYDKNIMTKVHGKRYAYKFDFQGL------------------------------------- 401
            ||||||:|.|:.|..|||:.|||:|..|                                     
  Rat   129 ALRYYYNKRILHKTKGKRFTYKFNFSKLIVADCPPWKVWTPSTPCLLLRPPALCQTALVPVAEQS 193

  Fly   402 ----------AAATQPA-----ASDPTYKYQSDLFMTPYHHSAKLSSF---MSP----------- 437
                      |..||||     ...|......|        |:..|||   :.|           
  Rat   194 EPLRSMLCTRATGTQPARERTPPQPPEASGDKD--------SSSFSSFGSVLGPGWQNPCCCFWN 250

  Fly   438 HHGMTSSSASIFPSAASWGNWGSPATNLYQPHSMSHVTP--SHVAPHLSSY---PHYAXPSSSGG 497
            |.|...|.||..|......||.         |....:.|  |...|.|.|.   |... |....|
  Rat   251 HQGDLPSFASFAPVPCLCCNWA---------HLSGPILPPLSSEQPLLESLKPGPRLPGPMWMPG 306

  Fly   498 AFXY-------------ESNAIASASGIGG 514
            |: :             |:..:..|.||||
  Rat   307 AWHFPGLHLLARLRQGTEAPEVPQAPGIGG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 53/85 (62%)
Etv3lNP_001382570.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.