DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and Ets97D

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster


Alignment Length:168 Identity:78/168 - (46%)
Similarity:97/168 - (57%) Gaps:26/168 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 QQGRISGSKSSNTSGTGGGASASGGGGSALYSSYKSSWGSHSSTQSQGYSSNALGIKHDPHSQLR 294
            :|.||..:.|.:|: :||..|.........|.|.|||....|:|.|.                  
  Fly   285 KQPRIMSANSISTN-SGGSLSLEQRIMRKSYQSVKSSDSVESTTSSM------------------ 330

  Fly   295 QPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGE 359
            .|..|...|       |..:||:||||||||:|:|..:...|.|.||.|||||||||.|||.|||
  Fly   331 NPSNYTTIG-------SGNNGQVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGE 388

  Fly   360 RKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFD 397
            :|:||.|||:|||||||||||.::::||.|||:|||||
  Fly   389 KKNKPAMNYEKLSRALRYYYDGDMISKVSGKRFAYKFD 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 57/82 (70%)
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 57/82 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.