DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and Etv2

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_038949886.1 Gene:Etv2 / 361544 RGDID:1310603 Length:368 Species:Rattus norvegicus


Alignment Length:264 Identity:91/264 - (34%)
Similarity:123/264 - (46%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PALP-SLTASSSSHVEHKV--RADKSTLDCATT-----SSHAAAPSSSSSASDHQQGRISGSKSS 240
            |||| ......:..|.|.:  ..|.:.|.|.|:     :|....|:...::.....| ..|:...
  Rat    94 PALPHEEVPFEAEPVAHPLPWSRDWTDLGCNTSDPWSCASQTPGPAPPGTSPSPFVG-FEGATGQ 157

  Fly   241 NTSGTGGGASA--------------------------SGGGGSALYSSYKSSWG-----SHSSTQ 274
            ||:.:.||..:                          ||.||.| .:.||.|||     .:::|.
  Rat   158 NTATSAGGVPSWSHPPATWSTASWDCSAGPNGSTYWDSGLGGEA-QADYKMSWGGSAGSDYTTTW 221

  Fly   275 SQGYSSNALGIK-HD------PHSQLRQPD-----PYQMFGPTSSRLASSGSGQIQLWQFLLELL 327
            :.|..:.::..: |.      |....:|.|     ||   ..|:.|      |.|||||||||||
  Rat   222 NSGLQNCSIPFEGHQIPAFATPSKSSQQSDRATLTPY---SKTNHR------GPIQLWQFLLELL 277

  Fly   328 SDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRY 392
            .|...:|||.|.|.|.||:|.||.||||.|||||.||.|||:||||.|||||.::|:.|..|::|
  Rat   278 HDGARSSCIRWTGNNREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDIVLKSGGRKY 342

  Fly   393 AYKF 396
            .|:|
  Rat   343 TYRF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 52/81 (64%)
Etv2XP_038949886.1 ETS 266..348 CDD:197710 52/81 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.