DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and Etv4

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_006247431.1 Gene:Etv4 / 360635 RGDID:1306524 Length:533 Species:Rattus norvegicus


Alignment Length:369 Identity:106/369 - (28%)
Similarity:136/369 - (36%) Gaps:112/369 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 QRHRLDTLQPPSGCS---PAVTQHG--VITSSA--------------GQVTSGTLDAVSAAPALP 187
            |..|.|   |...||   |....||  .:.|||              |......|...|.|....
  Rat   147 QSPRTD---PALSCSRKPPLSYHHGEQCLYSSAYDSPRQIAIKSPAPGAPGQSPLQPFSRAEPQQ 208

  Fly   188 SL---TASSSSHVEHKVRADKSTL------DC-ATTSSHAAAPSSSSSASDHQ------------ 230
            ||   ::||.||..|....:.|::      .| |.||..........:...||            
  Rat   209 SLLRASSSSQSHPGHGYLGEHSSVFQQPVDMCHAFTSPQGGGREPLPAPYQHQLSEPCPPYPQQS 273

  Fly   231 -------------------QGRISGSK-----------------SSNTSGTGG------GASASG 253
                               ||.:||.:                 .|:..|...      |.||..
  Rat   274 FKQEYHDPLYEQAGQPAASQGGVSGHRYPGAGVVIKQERTDFAYDSDVPGCASMYLHPEGFSAPS 338

  Fly   254 GGGSALYSSYKSSWGSHSS------TQSQGYSSNALGIKHDPHSQLRQPDPYQMFGPTSSRLASS 312
            .|...:...|:.|......      .:.:|      .||.:.....|:..|||.           
  Rat   339 SGDGVMGYGYEKSLRPFPDDVCIVPEKFEG------DIKQEGVGAFREGPPYQR----------- 386

  Fly   313 GSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRY 377
             .|.:||||||:.||.|..||..|.|.|...||||.:|:||||.||.:|::|.||||||||:|||
  Rat   387 -RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRY 450

  Fly   378 YYDKNIMTKVHGKRYAYKF--DFQGLAAATQPAASDPTYKYQSD 419
            ||:|.||.||.|:||.|||  :.:.|.:...|....|..|.:.|
  Rat   451 YYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNHRPALKAEFD 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 51/86 (59%)
Etv4XP_006247431.1 ETS_PEA3_N 53..388 CDD:282476 49/261 (19%)
ETS 390..473 CDD:197710 51/82 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.