DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and etv5a

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001119933.1 Gene:etv5a / 337626 ZFINID:ZDB-GENE-030131-9572 Length:524 Species:Danio rerio


Alignment Length:161 Identity:70/161 - (43%)
Similarity:88/161 - (54%) Gaps:23/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 IKHDPHSQLRQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTD 349
            :|.:| |..|:..|||.            .|.:||||||:.||.|.:|...|.|.|...||||.:
Zfish   358 VKQEP-SVYREGPPYQR------------RGSLQLWQFLVTLLDDPSNGHFIAWTGRGMEFKLIE 409

  Fly   350 PDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM--TKVHGKRYAYKF--DFQGLAAATQPAAS 410
            |:|||||||.:|::|.||||||||:|||||:|.||  .||.|:||.|||  |.:.|.:...|...
Zfish   410 PEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVKVAGERYVYKFVCDPEALFSMAFPDNQ 474

  Fly   411 DPTYKYQSDLFMT------PYHHSAKLSSFM 435
            .|..|...|...|      |..|....||::
Zfish   475 RPNLKADPDGLPTVDDDTLPLAHYDDGSSYL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 52/88 (59%)
etv5aNP_001119933.1 ETS_PEA3_N 2..375 CDD:309665 7/29 (24%)
ETS 376..462 CDD:197710 51/85 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.