DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and ets2

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001018874.1 Gene:ets2 / 326672 ZFINID:ZDB-GENE-050522-552 Length:439 Species:Danio rerio


Alignment Length:290 Identity:103/290 - (35%)
Similarity:129/290 - (44%) Gaps:66/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 CS-PAVTQHGVITSSAGQVTSGTLDAVSAAP----ALPSLTASSSSHVEHKVRADKSTLDCATTS 214
            || .|...|..:.....|.:.......|||.    |.|.|:..|..:..|:...:...|..|.:|
Zfish   183 CSLTAPNPHSSLLRELFQTSDDAALLASAAELPACAKPQLSTVSVRYRSHEFTKNTPQLRTAGSS 247

  Fly   215 SHAAAPSSSSSASDHQQGRISGSKSSNTSGTGGGASASGGGGSALYSSYKSSWGSHSS---TQS- 275
            ...|:..|..||.:                                 ....|||||||   ||. 
Zfish   248 GEQASQESVESAEE---------------------------------CVLRSWGSHSSLADTQRV 279

  Fly   276 ---QGYSSNALGIKHDPHSQ-----LRQPDPYQMFG----PTSSRLASSGSGQIQLWQFLLELLS 328
               ..:....|.:....|.:     :::.:..|..|    |.:.....:|||.|||||||||||:
Zfish   280 PSYDSFEEELLPLGLQKHGRSFKDYVQERNQTQETGRPVIPAAVLAGFTGSGPIQLWQFLLELLT 344

  Fly   329 DSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYA 393
            ||...|.|:|.|...|||||||||||||||:||:||.|||:||||.|||||||||:.|..||||.
Zfish   345 DSTCQSIISWTGDGWEFKLTDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYV 409

  Fly   394 YKF--DFQGLAAAT----------QPAASD 411
            |:|  |.|.|...|          ||.:.|
Zfish   410 YRFVCDLQNLLGYTVEELHGLLGVQPDSED 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 61/86 (71%)
ets2NP_001018874.1 SAM_superfamily 76..164 CDD:301707
ETS 332..416 CDD:197710 59/83 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.