DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and Etv6

DIOPT Version :10

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_038963620.1 Gene:Etv6 / 312777 RGDID:1559537 Length:464 Species:Rattus norvegicus


Alignment Length:79 Identity:35/79 - (44%)
Similarity:53/79 - (67%) Gaps:1/79 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 LWQFLLELLSDSNNASCITWEGTNGE-FKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKN 382
            ||.::.:|||||...:.|.||....: |::.||:.:||.||..|::.||.|:|:|||||:||..|
  Rat   353 LWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLN 417

  Fly   383 IMTKVHGKRYAYKF 396
            |:.|..|:|..::|
  Rat   418 IIRKEPGQRLLFRF 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 35/79 (44%)
Etv6XP_038963620.1 SAM_PNT-Tel_Yan 67..134 CDD:176085
ETS 350..436 CDD:197710 35/79 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.