DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and Etv3

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001099920.1 Gene:Etv3 / 295297 RGDID:1311577 Length:513 Species:Rattus norvegicus


Alignment Length:211 Identity:82/211 - (38%)
Similarity:100/211 - (47%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 ASSGSGQIQLWQFLLELLSDSNNASCITW-EGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSR 373
            :|.||.|||||.|:||||........|.| :|..|||.:.|||||||.||.||.||.||||||||
  Rat    28 SSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSR 92

  Fly   374 ALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTYKYQSDLFMTPYHHSAKLSSFMSPH 438
            ||||||:|.|:.|..|||:.|||:|                   |.|.|..|......||     
  Rat    93 ALRYYYNKRILHKTKGKRFTYKFNF-------------------SKLVMPNYPFINIRSS----- 133

  Fly   439 HGMTSSSASIFPSAASWGNWGSPATNLYQPHSMSHVTPSHVAP-HLSSYPHYAXPSSSGGAFXYE 502
             |:...||...|:|:|         ..:.|...:|.....|.| ..|:....|....||||    
  Rat   134 -GVVPQSAPPVPTASS---------RFHFPPLDTHSPTGDVQPGRFSASSLSASCPESGGA---- 184

  Fly   503 SNAIASASGIGGGTAS 518
            ::.....|.:..|:||
  Rat   185 ADRKVEPSDLEDGSAS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 53/85 (62%)
Etv3NP_001099920.1 ETS 34..120 CDD:197710 54/104 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.