DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and Fev

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_694751.1 Gene:Fev / 260298 MGIID:2449712 Length:237 Species:Mus musculus


Alignment Length:247 Identity:118/247 - (47%)
Similarity:139/247 - (56%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PDPY----------QMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDP 350
            |||.          ..:||.|..: ..|||||||||||||||:|..||.||.|||.:||||||||
Mouse    17 PDPVGDGLFKEGKSPSWGPLSPAV-QKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDP 80

  Fly   351 DEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQP-------- 407
            ||||||||||||||||||||||||||||||||||:|||||||||:|||||||.|.||        
Mouse    81 DEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPPAHAHAA 145

  Fly   408 --------AASD-PTYKYQSDLFMTPYHHSAKLSSFMSPHHGMTSSSASIFPSAASWGNWGSP-A 462
                    ||.| ..||..:.|...|:...:||:        :.::||.:.|:..|:  |..| |
Mouse   146 AAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLN--------LMAASAGVAPAGFSY--WPGPNA 200

  Fly   463 TNLYQPHSMSHVTPSHVAPHLSSYPHYAXPSSSGGAFXYESNAIASASGIGG 514
            |......:..:.||....|          |...|        |:|:||.:||
Mouse   201 TAAAAATAALYPTPGLQPP----------PGPFG--------AVAAASHLGG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 75/84 (89%)
FevNP_694751.1 ETS 46..131 CDD:197710 75/84 (89%)
May mediate active transcriptional repression. /evidence=ECO:0000250 129..237 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3194
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3711
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.750

Return to query results.
Submit another query.