DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and Fev

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_653354.2 Gene:Fev / 246271 RGDID:628860 Length:237 Species:Rattus norvegicus


Alignment Length:247 Identity:118/247 - (47%)
Similarity:139/247 - (56%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PDPY----------QMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDP 350
            |||.          ..:||.|..: ..|||||||||||||||:|..||.||.|||.:||||||||
  Rat    17 PDPVGDGLFKEGKSPSWGPLSPAV-QKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDP 80

  Fly   351 DEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQP-------- 407
            ||||||||||||||||||||||||||||||||||:|||||||||:|||||||.|.||        
  Rat    81 DEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPPAHAHAA 145

  Fly   408 --------AASD-PTYKYQSDLFMTPYHHSAKLSSFMSPHHGMTSSSASIFPSAASWGNWGSP-A 462
                    ||.| ..||..:.|...|:...:||:        :.::||.:.|:..|:  |..| |
  Rat   146 AAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLN--------LMAASAGVAPAGFSY--WPGPNA 200

  Fly   463 TNLYQPHSMSHVTPSHVAPHLSSYPHYAXPSSSGGAFXYESNAIASASGIGG 514
            |......:..:.||....|          |...|        |:|:||.:||
  Rat   201 TAAAAATAALYPTPGLQPP----------PGPFG--------AVAAASHLGG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 75/84 (89%)
FevNP_653354.2 ETS 46..131 CDD:197710 75/84 (89%)
May mediate active transcriptional repression. /evidence=ECO:0000250 129..237 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1113327at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.