DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and Ets2

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_035939.3 Gene:Ets2 / 23872 MGIID:95456 Length:468 Species:Mus musculus


Alignment Length:323 Identity:108/323 - (33%)
Similarity:147/323 - (45%) Gaps:82/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 VSSSTAGV-LSSSGNGVQR------HRLDTLQPPSGCSPAVTQHGVITSSAGQVTSGTLDAVSAA 183
            ::|:|.|. :..:..|:|.      :.||::.||                            ||.
Mouse   191 INSNTLGFSMEQAPYGMQAPNYPKDNLLDSMCPP----------------------------SAT 227

  Fly   184 PALPSLTASSSSHVEHKVRADKSTLDCATTSSHAAAPSSSSSASDHQQGRISGSKSSNTSGTGGG 248
            |      |:..|.::...::..:|::....|.....|||:.:..::..|:   .|..::...||.
Mouse   228 P------AALGSELQMLPKSRLNTVNVNYCSISQDFPSSNVNLLNNNSGK---PKDHDSPENGGD 283

  Fly   249 ASASGGGGSALYSSYKSSWGSHSSTQ---------------SQGYSSNALGIKHDPHSQLRQPDP 298
            :..|.       .|...||.|.||..               ||....:.|.:....:.|.|. ||
Mouse   284 SFESS-------DSLLRSWNSQSSLLDVQRVPSFESFEEDCSQSLCLSKLTMSFKDYIQERS-DP 340

  Fly   299 YQMFGPT--SSRLAS-SGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGER 360
            .:...|.  ::.||. :|||.|||||||||||||.:..|.|:|.|...||||.||||||||||:|
Mouse   341 VEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKR 405

  Fly   361 KSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF--DFQGLAAAT----------QPAASD 411
            |:||.|||:||||.|||||||||:.|..||||.|:|  |.|.|...|          ||...|
Mouse   406 KNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 60/86 (70%)
Ets2NP_035939.3 SAM_PNT-ETS-2 85..173 CDD:188884
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..290 5/37 (14%)
ETS 361..445 CDD:197710 58/83 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.