DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and ETV3

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001138784.1 Gene:ETV3 / 2117 HGNCID:3492 Length:512 Species:Homo sapiens


Alignment Length:225 Identity:82/225 - (36%)
Similarity:108/225 - (48%) Gaps:38/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 ASSGSGQIQLWQFLLELLSDSNNASCITW-EGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSR 373
            :|.||.|||||.|:||||........|.| :|..|||.:.|||||||.||.||.||.||||||||
Human    28 SSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSR 92

  Fly   374 ALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTYKYQSDLFMTPYHHSAKLSSFMSPH 438
            ||||||:|.|:.|..|||:.|||:|..|..        |.|.:            ..:.|     
Human    93 ALRYYYNKRILHKTKGKRFTYKFNFNKLVM--------PNYPF------------INIRS----- 132

  Fly   439 HGMTSSSASIFPSAASWGNWGSPATNLYQPHSMSHVTPSHVAPHLSSYPHYAXPSSSGGAFXYES 503
            .|:...||...|:|:|  .:..|..:.:.|  .:.|.|...:  .||.......||:|.....|.
Human   133 SGVVPQSAPPVPTASS--RFHFPPLDTHSP--TNDVQPGRFS--ASSLTASGQESSNGTDRKTEL 191

  Fly   504 NAIASAS------GIGGGTASTGVGIGGVG 527
            :.:...|      |:...::...:|.||:|
Human   192 SELEDGSAADWRRGVDPVSSRNAIGGGGIG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 53/85 (62%)
ETV3NP_001138784.1 ETS 34..120 CDD:197710 53/85 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..222 21/92 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..512
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.