DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and ETV1

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_011513469.1 Gene:ETV1 / 2115 HGNCID:3490 Length:491 Species:Homo sapiens


Alignment Length:158 Identity:68/158 - (43%)
Similarity:91/158 - (57%) Gaps:19/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 RQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWG 358
            ::|..|:. |||..|     .|.:||||||:.||.|.:|:..|.|.|...||||.:|:|||||||
Human   332 QEPGMYRE-GPTYQR-----RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWG 390

  Fly   359 ERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF--DFQGLAAATQPAASDPTYKYQSDLF 421
            .:|::|.||||||||:|||||:|.||.||.|:||.|||  |.:.|.:...|....|..|...:..
Human   391 IQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERH 455

  Fly   422 M-----TPYHHSAKLSSFM------SPH 438
            :     .|..|..:..::|      :||
Human   456 INEEDTVPLSHFDESMAYMPEGGCCNPH 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 52/86 (60%)
ETV1XP_011513469.1 ETS_PEA3_N 29..347 CDD:282476 6/20 (30%)
ETS 348..432 CDD:197710 51/83 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.