DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and ETS1

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001137292.1 Gene:ETS1 / 2113 HGNCID:3488 Length:485 Species:Homo sapiens


Alignment Length:190 Identity:84/190 - (44%)
Similarity:100/190 - (52%) Gaps:34/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 GGASASGGGGSALYSSYKS---------SWGSHSSTQS----QGYSS------NALGIKHDP--- 289
            |..|....||...:.|.:|         ||.|.||..|    ..|.|      .|....|.|   
Human   283 GRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGT 347

  Fly   290 -------HSQLRQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKL 347
                   .:.|.:..|..   |.::....:|||.|||||||||||:|.:..|.|:|.|...||||
Human   348 FKDYVRDRADLNKDKPVI---PAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKL 409

  Fly   348 TDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF--DFQGLAAAT 405
            :||||||||||:||:||.|||:||||.|||||||||:.|..||||.|:|  |.|.|...|
Human   410 SDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 59/86 (69%)
ETS1NP_001137292.1 SAM_PNT-ETS-1 95..182 CDD:176092
ETS 378..462 CDD:197710 57/83 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.