Sequence 1: | NP_001303373.1 | Gene: | Ets65A / 38700 | FlyBaseID: | FBgn0005658 | Length: | 728 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001964.2 | Gene: | ELK4 / 2005 | HGNCID: | 3326 | Length: | 431 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 71/197 - (36%) |
---|---|---|---|
Similarity: | 97/197 - (49%) | Gaps: | 50/197 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 317 IQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDK 381
Fly 382 NIMTKVHGKRYAYKF------------------------DFQGLAAAT------------QPAAS 410
Fly 411 DPTYKYQSDLFMTPYHHSAKLSSFMSPHHGMTSSSASIFPSAASWGNWGSPATNLYQPHSMSHVT 475
Fly 476 PS 477 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets65A | NP_001303373.1 | ETS | 316..401 | CDD:197710 | 51/107 (48%) |
ELK4 | NP_001964.2 | ETS | 17..88 | CDD:197710 | 41/70 (59%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 114..139 | 3/27 (11%) | |||
Herpes_DNAp_acc | <237..323 | CDD:282746 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 251..282 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 294..323 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 411..431 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3806 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |