DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and ELK4

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001964.2 Gene:ELK4 / 2005 HGNCID:3326 Length:431 Species:Homo sapiens


Alignment Length:197 Identity:71/197 - (36%)
Similarity:97/197 - (49%) Gaps:50/197 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 IQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDK 381
            |.||||||:||....|...|.|...:|:|||...:||||.||.||:|||||||||||||||||.|
Human     5 ITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVK 69

  Fly   382 NIMTKVHGKRYAYKF------------------------DFQGLAAAT------------QPAAS 410
            ||:.||:|:::.|||                        :|..:::::            ||.|.
Human    70 NIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAK 134

  Fly   411 DPTYKYQSDLFMTPYHHSAKLSSFMSPHHGMTSSSASIFPSAASWGNWGSPATNLYQPHSMSHVT 475
            ..:   ::|     |.||...|||..  :.:.||:..:|....:    .:||..|.:..|....|
Human   135 TSS---RND-----YIHSGLYSSFTL--NSLNSSNVKLFKLIKT----ENPAEKLAEKKSPQEPT 185

  Fly   476 PS 477
            ||
Human   186 PS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 51/107 (48%)
ELK4NP_001964.2 ETS 17..88 CDD:197710 41/70 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..139 3/27 (11%)
Herpes_DNAp_acc <237..323 CDD:282746
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..282
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..323
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.