Sequence 1: | NP_001303373.1 | Gene: | Ets65A / 38700 | FlyBaseID: | FBgn0005658 | Length: | 728 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107595.1 | Gene: | ELK1 / 2002 | HGNCID: | 3321 | Length: | 428 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 76/199 - (38%) |
---|---|---|---|
Similarity: | 98/199 - (49%) | Gaps: | 27/199 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 317 IQLWQFLLELLSDSNNASCITWEGTN-GEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYD 380
Fly 381 KNIMTKVHGKRYAYKF-DFQGLA-AATQPAASDPTYKYQSDLFMTPYHHSAKLSSFMSPHHGMTS 443
Fly 444 SSASIFPSAASWGNWGSPA---------TNLY--------QPHSMSHVTPSHVAPHLSSYPHYAX 491
Fly 492 PSSS 495 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets65A | NP_001303373.1 | ETS | 316..401 | CDD:197710 | 51/85 (60%) |
ELK1 | NP_001107595.1 | ETS | 4..89 | CDD:197710 | 51/83 (61%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 121..149 | 8/29 (28%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 165..205 | 10/32 (31%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 228..358 | ||||
Sufficient for interaction with MAD2L2. /evidence=ECO:0000269|PubMed:17296730 | 349..399 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |