DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and SPIC

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_689536.1 Gene:SPIC / 121599 HGNCID:29549 Length:248 Species:Homo sapiens


Alignment Length:234 Identity:54/234 - (23%)
Similarity:97/234 - (41%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 GGSALYSSYKS-----SWGSHSSTQSQGYSSNAL--GIKHDPHSQLRQPDPYQMFGPTSSRLASS 312
            |.|:.|....:     :|.:..::.:..|....:  .:::...:||.||...|..|       ..
Human    49 GNSSCYGVLPTEEPVYNWRTVINSAADFYFEGNIHQSLQNITENQLVQPTLLQQKG-------GK 106

  Fly   313 GSGQIQLWQFLLELLSDSNNASCITW-EGTNGEFKLT--DPDEVARRWGERK-SKPNMNYDKLSR 373
            |..:::|:::|.|.|.:...||||.| :.|.|.|:..  :.:::|..||:|| ::..|.|.|::|
Human   107 GRKKLRLFEYLHESLYNPEMASCIQWVDKTKGIFQFVSKNKEKLAELWGKRKGNRKTMTYQKMAR 171

  Fly   374 ALRYYYDKNIMTKVHGKRYAYKFD---FQGLAAATQPAASDPTYKYQSDLFMTPYHHSAKLSSFM 435
            |||.|.....:||:. ::..|:|.   .|.|:         |:|....::|         .|..:
Human   172 ALRNYGRSGEITKIR-RKLTYQFSEAILQRLS---------PSYFLGKEIF---------YSQCV 217

  Fly   436 SPHHGMTSSSASIFPSAASWGNWGSPATNLY-QPHSMSH 473
            .|..           ...|..||.:.....| ..|.::|
Human   218 QPDQ-----------EYLSLNNWNANYNYTYANYHELNH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 30/91 (33%)
SPICNP_689536.1 Ets 116..194 CDD:306647 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.