DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and LOC100537796

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_009297062.2 Gene:LOC100537796 / 100537796 -ID:- Length:269 Species:Danio rerio


Alignment Length:194 Identity:77/194 - (39%)
Similarity:94/194 - (48%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 SSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRAL 375
            |.||.|:|||.||||||. ......|||....|||.:.||:.:|:.|||||.||:||||||||||
Zfish    33 SPGSRQVQLWHFLLELLG-RGEGGAITWGSEWGEFVIRDPERLAKLWGERKGKPHMNYDKLSRAL 96

  Fly   376 RYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTYKYQSDLFMTPYHHSAKLSSFMSPHHG 440
            ||||:|.|:.|..|||:.|:|:|..|.....|  |.||....     ||                
Zfish    97 RYYYNKRILHKTKGKRFTYRFNFSKLILVNYP--SLPTCPQN-----TP---------------- 138

  Fly   441 MTSSSASIFPSAASWGN-------WGSPATNLYQPHSMSHVTP-SHVAPHLSSYPHYAXPSSSG 496
              |:..|:|||..|:.|       ..|.:..|..|:|.....| ..|.|.....|.:. |..||
Zfish   139 --SAPFSVFPSQLSFYNSSIDRASMQSISHPLLLPYSFPKPLPFPQVHPIQRQIPFFPGPPPSG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 49/84 (58%)
LOC100537796XP_009297062.2 ETS 38..122 CDD:197710 49/84 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.