DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and fev

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_002934005.1 Gene:fev / 100485880 XenbaseID:XB-GENE-853582 Length:219 Species:Xenopus tropicalis


Alignment Length:244 Identity:123/244 - (50%)
Similarity:143/244 - (58%) Gaps:47/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 ASGGGGSALYSSYKSSWGSHSSTQSQGYSSNALGIKHDP--HSQLRQPDPYQMFGPTSSRLASSG 313
            |.|.|...|.:.|.:                      ||  .|.|::|.. |.:.|.||.: ..|
 Frog     2 AQGSGSQLLLNMYLT----------------------DPVGESFLKEPRS-QSWRPFSSGV-QKG 42

  Fly   314 SGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYY 378
            ||||||||||||||||..||:||.|||||||||||||||||||||||||||||||||||||||||
 Frog    43 SGQIQLWQFLLELLSDHANANCIAWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYY 107

  Fly   379 YDKNIMTKVHGKRYAYKFDFQGLAAATQ--PAASDPTYKYQSDLFMTPYHHSAKLSSFMSPHHGM 441
            ||||||.|||||||||||||.|||...|  |......||:|.:|...|:...:||:...|   |:
 Frog   108 YDKNIMAKVHGKRYAYKFDFHGLAQVCQSAPTTEQGLYKFQGNLPHLPFSGLSKLNLMTS---GV 169

  Fly   442 TSSSASIFPSAASWGNWGSPATNLYQPHSMSHVTP-----SHVAPHLSS 485
            :.:..|.:|        |:|:. ||..|.:.  :|     |..||||.|
 Frog   170 SPAGFSYWP--------GTPSA-LYPSHGLQ--SPPGGFSSVSAPHLGS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 78/84 (93%)
fevXP_002934005.1 ETS 45..130 CDD:197710 78/84 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1113327at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.