DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets65A and etv3

DIOPT Version :9

Sequence 1:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001090698.1 Gene:etv3 / 100036677 XenbaseID:XB-GENE-852742 Length:531 Species:Xenopus tropicalis


Alignment Length:303 Identity:90/303 - (29%)
Similarity:112/303 - (36%) Gaps:124/303 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 ASSGSGQIQLWQFLLELLSDSNNASCITW-EGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSR 373
            :|.||.|||||.|:||||........|.| :|..|||.:.|||||||.||.||.||.||||||||
 Frog    28 SSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSR 92

  Fly   374 ALRYYYDKNIMTKVHGKRYAYKFDFQGLA------------AATQPAASDPT------------- 413
            ||||||:|.|:.|..|||:.|||:|..|.            |..|.|...||             
 Frog    93 ALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRPNAVPQSAPPVPTASSHFHFPPLDSP 157

  Fly   414 --------------------------------------------------------------YKY 416
                                                                          .|:
 Frog   158 SEDAQGSRFSGNSTAQSSRESLNEVADRKANSSEQDDISSDWRRSADLMAPRNPVGLSHPALQKH 222

  Fly   417 QSDL----FMTPYHHSAKLSSF-MSPHHGM-------TSSSASIFPSAASWGNWGSPATNL---- 465
            :|||    |..|..::...|.| :||..|.       .|.:.|:.|:..|:    ||:..|    
 Frog   223 KSDLMLPVFPMPGMYADPHSPFALSPLPGRGSILNVPISPALSLTPTVFSY----SPSPGLSPAF 283

  Fly   466 -------YQPHSMSH--------VTPSHVAPH-LSSYPHYAXP 492
                   :.|..|.|        |...|::|. |..||.:..|
 Frog   284 QSGSCFNFNPEEMKHYLQAQACSVLNYHLSPRTLPRYPGFMMP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 53/85 (62%)
etv3NP_001090698.1 ETS 34..120 CDD:197710 53/85 (62%)
PRK10263 <225..>460 CDD:236669 26/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.