DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and ERP4

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_014659.1 Gene:ERP4 / 854181 SGDID:S000005542 Length:207 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:40/190 - (21%)
Similarity:76/190 - (40%) Gaps:22/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NLPAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVRGGDGMAGFAVRNPAGEVVKPYQWQAT 104
            :|||..          ||..|:..........||:.|:.||:....|.:..|.|.|:...:.:..
Yeast    30 SLPAFT----------KECLYYDLSSDKDVLVVSYQVLTGGNFEIDFDITAPDGSVIVTERQKKH 84

  Fly   105 ADYTDQVSPGGYYSVCIDNQFSRFAGKLVNIYITVVKYDAWDKYAKEIEQLQLNMQNFTA--TVG 167
            :|:..:....|.|:.|:.|.:.....|   :.||:.|       .|||.....:.::..|  .:.
Yeast    85 SDFLLKSFGIGKYTFCLSNNYGTSPKK---VEITLEK-------EKEIVSSHESKEDIIANNAIE 139

  Fly   168 TVERNINDMMGYQAHSRHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLF 227
            .::||:|.:.....:.|.||.|:...:....:.:...|:..:.|::....||...::..|
Yeast   140 EIDRNLNKITKTMDYLRAREWRNMYTVSSTESRLTWLSLLIMGVMVGISIVQALIIQFFF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 37/183 (20%)
ERP4NP_014659.1 EMP24_GP25L 29..199 CDD:395878 39/188 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.