DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and EMP24

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_011315.3 Gene:EMP24 / 852675 SGDID:S000003168 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:47/235 - (20%)
Similarity:77/235 - (32%) Gaps:64/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ICCCLLIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVRGGDGM 83
            :..|.|....||.....|.|                |:. |:.:.:..|....:||.        
Yeast     9 VIACFLFFSASAHNVLLPAY----------------GRR-CFFEDLSKGDELSISFQ-------- 48

  Fly    84 AGFAVRNPAG----------------EVVKPYQWQATADYTDQVSPGGYYSVCIDNQFSRFAGKL 132
              |..|||..                ||:|..:..:..:.|......|::..|..|:.:....|.
Yeast    49 --FGDRNPQSSSQLTGDFIIYGPERHEVLKTVRDTSHGEITLSAPYKGHFQYCFLNENTGIETKD 111

  Fly   133 VNIYITVVKY-DAWDKYAKEIEQLQLNMQNFTATVGTVERNINDMMGY-----QAHSRHRESRDY 191
            |...|..|.| |..|.....::.....:...|       |.:.|...|     :.|....||   
Yeast   112 VTFNIHGVVYVDLDDPNTNTLDSAVRKLSKLT-------REVKDEQSYIVIRERTHRNTAES--- 166

  Fly   192 ALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVKS 231
                 .|..::.:||.|:.|::.....|::::|:.|||.|
Yeast   167 -----TNDRVKWWSIFQLGVVIANSLFQIYYLRRFFEVTS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 37/202 (18%)
EMP24NP_011315.3 EMP24_GP25L 20..198 CDD:395878 40/219 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.