DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and ERP3

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_010266.1 Gene:ERP3 / 851544 SGDID:S000002176 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:41/228 - (17%)
Similarity:89/228 - (39%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AVAMDYKVHIDAGKEDC-------------YHQYVKAGAT--FYVSFSVVRGGDGMAGFAVRNPA 92
            |.|......::.|:::|             |:..|:.|.:  |.|::.:....|.......|  :
Yeast    19 AEASPLTFELNKGRKECLYTLTPEIDCTISYYFAVQQGESNDFDVNYEIFAPDDKNKPIIER--S 81

  Fly    93 GEVVKPYQWQATADYTDQVSPGGYYSVCIDNQFSRFAGKLVNIYITV-VKY------DAWDKYAK 150
            ||  :..:|.....:.      |.|::|.      :.||..:..:.: .||      |..::..|
Yeast    82 GE--RQGEWSFIGQHK------GEYAICF------YGGKAHDKIVDLDFKYNCERQDDIRNERRK 132

  Fly   151 -----------EIEQLQLNMQNFTATVGTVERNINDMMGYQAHSRHRESRDYALLLDNNAYIQTF 204
                       :.:.||.:::|   ::.|:||.::.:.....:.:.|.:|::..:......|..|
Yeast   133 ARKAQRNLRDSKTDPLQDSVEN---SIDTIERQLHVLERNIQYYKSRNTRNHHTVCSTEHRIVMF 194

  Fly   205 SISQIVVILITCSVQVFFVRKLFEVKSSSKSRI 237
            ||..|::|:.....|:..:..:|  :.|.|..:
Yeast   195 SIYGILLIIGMSCAQIAILEFIF--RESRKHNV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 36/213 (17%)
ERP3NP_010266.1 EMP24_GP25L 23..218 CDD:395878 37/215 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.