DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and ERP2

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_009395.1 Gene:ERP2 / 851226 SGDID:S000000005 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:50/219 - (22%)
Similarity:93/219 - (42%) Gaps:20/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVLPIALICCCL-LIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFS 75
            :.||...|...| |::..:|..:..|...:|||.:          ||..|:..|....:..|.:.
Yeast     6 IALPSFFIVLILALVNSVAASSSYAPVAISLPAFS----------KECLYYDMVTEDDSLAVGYQ 60

  Fly    76 VVRGGDGMAGFAVRNPAGEVVKPYQWQATADYTDQVSPGGYYSVCIDNQFSRFAGKLVNIYITVV 140
            |:.||:....|.:..|.|.|:...:.:..:|:..:....|.|:.|..|.:..   .|..:.||:.
Yeast    61 VLTGGNFEIDFDITAPDGSVITSEKQKKYSDFLLKSFGVGKYTFCFSNNYGT---ALKKVEITLE 122

  Fly   141 KYDAWDKYAKEIEQLQLNMQNFTA--TVGTVERNINDMMGYQAHSRHRESRDYALLLDNNAYIQT 203
            |    :|...:..:..:|..:..|  .|..::||:|.:.....:.|.||.|:.:.:....:.:..
Yeast   123 K----EKTLTDEHEADVNNDDIIANNAVEEIDRNLNKITKTLNYLRAREWRNMSTVNSTESRLTW 183

  Fly   204 FSISQIVVILITCSVQVFFVRKLF 227
            .||..|::|.:....||..::.||
Yeast   184 LSILIIIIIAVISIAQVLLIQFLF 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 40/183 (22%)
ERP2NP_009395.1 EMP24_GP25L 34..183 CDD:395878 35/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.