DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and p24beta2

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_187425.1 Gene:p24beta2 / 819959 AraportID:AT3G07680 Length:208 Species:Arabidopsis thaliana


Alignment Length:204 Identity:45/204 - (22%)
Similarity:86/204 - (42%) Gaps:58/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KEDCY-HQYVKAGATFYVSFSVVRGG-------DGMAGFAVRNPAGEVVKPYQWQATADYTDQVS 112
            :|:|: |:....|.|.:|||.|::..       ||: ...:..|.||.:..::.|.:|.:...|.
plant    28 REECFSHKAEYEGDTLHVSFVVIKSDSQWHFNEDGV-DLVIHGPTGEQIHDFREQISAKHDFVVQ 91

  Fly   113 PGGYYSVCIDNQFSRFAGKLVNIYITVVKYDA-------WDKYAKEIEQLQLNMQNFTATVGTVE 170
            ..|.|..|..|:         :.|...:.:|.       :|::||:        ::||..:..:.
plant    92 KKGVYRFCFTNK---------SPYHETIDFDVQLGHFAYYDQHAKD--------EHFTPLMEQIS 139

  Fly   171 R------NINDMMGYQAHSRHRESRDYALLLDN-------NAYIQTFSISQIVVILITCS-VQVF 221
            :      ||.    ::.|....::...|::.:|       .|..::|:       ||..| :||:
plant   140 KLEEALYNIQ----FEQHWLEAQTDRQAIVNENMSKRAVHKALFESFA-------LIGASFLQVY 193

  Fly   222 FVRKLFEVK 230
            .:|:|||.|
plant   194 LLRRLFERK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 42/200 (21%)
p24beta2NP_187425.1 EMP24_GP25L 21..200 CDD:279450 42/200 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.