DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and Tmed7

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_079974.1 Gene:Tmed7 / 66676 MGIID:1913926 Length:224 Species:Mus musculus


Alignment Length:196 Identity:42/196 - (21%)
Similarity:84/196 - (42%) Gaps:4/196 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVRGGDGMAGFAVRNPAGEVVKPYQWQATAD 106
            |:...:....:....:.|:::.:..|....:.|.|:.||.......:.:|.|:|:.....:....
Mouse    31 PSGGSEITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDS 95

  Fly   107 YTDQVSPGGYYSVCIDNQFSRFAGKLVNIYITVVKYDAWDKYAKEIEQLQLNMQNFTATVGTVER 171
            :|...|..|.|..|..|:||.|..|.|.....|.:..........:..|   .|..:|.| ::..
Mouse    96 FTFTASRNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSAL---TQMESACV-SIHE 156

  Fly   172 NINDMMGYQAHSRHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVKSSSKSR 236
            .:..::.||.|.|.||::..:...|.|..:..:|:.:.:::|:....|||.::..|..|.::.:|
Mouse   157 ALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSVGQVFLLKSFFSDKRTTTTR 221

  Fly   237 I 237
            :
Mouse   222 V 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 38/180 (21%)
Tmed7NP_079974.1 EMP24_GP25L 36..213 CDD:307313 38/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.