DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and tmed5

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_031755940.1 Gene:tmed5 / 549314 XenbaseID:XB-GENE-951292 Length:223 Species:Xenopus tropicalis


Alignment Length:201 Identity:48/201 - (23%)
Similarity:98/201 - (48%) Gaps:12/201 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVRGGDGMAGFAVRNPAGEVVKPYQWQATADY 107
            :|..||...:.||:::|:.|.:|..||..:.:.|:.|......|::.:|.||::...:.|:...:
 Frog    25 SVDSDYTFTLPAGQKECFFQPMKRDATLEIEYQVLDGAGLDVDFSLTSPNGELLLSEERQSDGVH 89

  Fly   108 TDQVSPGGYYSVCIDNQFSRFAGKLVNIYITVV---------KYDAWDKYAKEIEQLQLNMQNFT 163
            :.:...|. |..|.||.|||.:.|:  |:..::         :.:.|..|....:.|.:.:::..
 Frog    90 SVETIDGD-YQFCFDNSFSRMSEKV--IFFELILDHLNDEGNELEDWKSYITGTDLLDMKLEDIL 151

  Fly   164 ATVGTVERNINDMMGYQAHSRHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFE 228
            .|:.:|:..:......|...:..|:||..|...|...:..:|:..:.|:::..::||:.:|.|||
 Frog   152 ETINSVKGRLTKSAQIQTLLKAFEARDRNLQESNFERVTFWSVFNLTVMVVVSALQVYMLRSLFE 216

  Fly   229 VKSSSK 234
            .|..|:
 Frog   217 DKRKSR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 43/189 (23%)
tmed5XP_031755940.1 EMP24_GP25L 29..216 CDD:395878 43/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.