DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and TMED7

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_861974.1 Gene:TMED7 / 51014 HGNCID:24253 Length:224 Species:Homo sapiens


Alignment Length:196 Identity:43/196 - (21%)
Similarity:84/196 - (42%) Gaps:4/196 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVRGGDGMAGFAVRNPAGEVVKPYQWQATAD 106
            |..|.:....:....:.|:::.:..|....:.|.|:.||.......:.:|.|:|:.....:....
Human    31 PGGASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDS 95

  Fly   107 YTDQVSPGGYYSVCIDNQFSRFAGKLVNIYITVVKYDAWDKYAKEIEQLQLNMQNFTATVGTVER 171
            :|...|..|.|..|..|:||.|..|.|.....|.:..........:..|   .|..:|.| ::..
Human    96 FTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSAL---TQMESACV-SIHE 156

  Fly   172 NINDMMGYQAHSRHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVKSSSKSR 236
            .:..::.||.|.|.||::..:...|.|..:..:|:.:.:::|:....|||.::..|..|.::.:|
Human   157 ALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTR 221

  Fly   237 I 237
            :
Human   222 V 222

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 38/180 (21%)
TMED7NP_861974.1 EMP24_GP25L 36..213 CDD:307313 38/180 (21%)
COPI vesicle coat-binding. /evidence=ECO:0000255 211..224 3/12 (25%)