DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and TMED5

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_057124.3 Gene:TMED5 / 50999 HGNCID:24251 Length:229 Species:Homo sapiens


Alignment Length:235 Identity:49/235 - (20%)
Similarity:110/235 - (46%) Gaps:15/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DQINLVLPIALICCCLLIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFYV 72
            |:|.|..|:.|:.....:.:..|...       .|::..|:...:.||:::|::|.:...|:..:
Human     3 DKIWLPFPVLLLAALPPVLLPGAAGF-------TPSLDSDFTFTLPAGQKECFYQPMPLKASLEI 60

  Fly    73 SFSVVRGGDGMAGFAVRNPAGEVVKPYQWQATADYTDQVSPGGYYSVCIDNQFSRFAGKLV---- 133
            .:.|:.|......|.:.:|.|:.:...|.::...:|.:...|. |..|.||.||..:.|::    
Human    61 EYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETEVGD-YMFCFDNTFSTISEKVIFFEL 124

  Fly   134 ---NIYITVVKYDAWDKYAKEIEQLQLNMQNFTATVGTVERNINDMMGYQAHSRHRESRDYALLL 195
               |:.....:.:.|.||....:.|.:.:::...::.:::..::.....|...|..|:||..:..
Human   125 ILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQE 189

  Fly   196 DNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVKSSSKS 235
            .|...:..:|:..:||:::..::||:.::.|||.|..|::
Human   190 SNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDKRKSRT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 38/187 (20%)
TMED5NP_057124.3 EMP24_GP25L 35..222 CDD:279450 38/187 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.