DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and tmed6

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001186530.1 Gene:tmed6 / 496652 XenbaseID:XB-GENE-967876 Length:236 Species:Xenopus tropicalis


Alignment Length:238 Identity:56/238 - (23%)
Similarity:111/238 - (46%) Gaps:20/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLPIALICCCLLIDVTSAQEAQ---QPWYENL--PAVAMDYKVHIDAGKEDCYHQYVKAGATFYV 72
            :||:.:.....|: .::||:::   .|..::|  .|...|:.|.:..|..:|:..:......||.
 Frog     1 MLPVVVFLLAHLL-FSTAQKSEPLSDPNAQSLFRGADRYDFAVLLGPGGTECFWHFAHQEGYFYY 64

  Fly    73 SFSVVRGGDGMAGFAVRNPAGEVVKP--YQWQATADYTDQVS----PGGYYSVCIDNQFSRFAGK 131
            .:.|......|..   |:.......|  :|.:.:.|...|::    ..|:|.:|::|..:.|.  
 Frog    65 GYEVQWTSGIMQN---RHVTASAFTPEGFQIEQSQDTRGQINFKTKETGFYQICVNNWQNSFG-- 124

  Fly   132 LVNIYITV-VKYDAWDKYAKEIEQLQLN--MQNFTATVGTVERNINDMMGYQAHSRHRESRDYAL 193
            ...:|:.. |.||.......|.::.:||  :.....:...|:..:..|..|...:|.|:..||.:
 Frog   125 QAQVYLNFGVFYDGVGPEHVEDQKQKLNDTLVTIEESAQIVQNRVLHMWRYYNFARMRKGSDYYI 189

  Fly   194 LLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVKSSSKSR 236
            ||.|..|:..:|.||.|:|:.:..:|::|:::||.||:::.|:
 Frog   190 LLSNYHYVNWWSASQSVLIVASGVLQLYFLKRLFNVKTTTDSQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 44/189 (23%)
tmed6NP_001186530.1 EMP24_GP25L 39..224 CDD:366467 44/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1262544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.