DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and tmed7

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001300637.1 Gene:tmed7 / 405848 ZFINID:ZDB-GENE-040426-2570 Length:216 Species:Danio rerio


Alignment Length:225 Identity:52/225 - (23%)
Similarity:98/225 - (43%) Gaps:19/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLPIALICCCLLIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVV 77
            :||:.:....:.:.::||.|..   :| ||          |..|: |:::.:..|....:.|.||
Zfish     9 LLPLFVQVVMMKVGLSSASELT---FE-LP----------DNAKQ-CFYEDITIGTKCTLEFQVV 58

  Fly    78 RGGDGMAGFAVRNPAGEVVKPYQWQATADYTDQVSPGGYYSVCIDNQFSRFAGKLVNIYITVVKY 142
            .||.......:.:|.|.|:.....:....:|...:..|.|..|..|:||.|..|  .:|......
Zfish    59 TGGHYDVDCRLEDPEGTVLYKEMKKQYDSFTFSAARNGTYKFCFSNEFSTFTHK--TVYFDFQVG 121

  Fly   143 DAWDKYAKEIEQLQLNMQNFTATVGTVERNINDMMGYQAHSRHRESRDYALLLDNNAYIQTFSIS 207
            |....:..|.....|. |..:|.| ::...:..:|.||.|.|.||::..:...|.|:.:..:|:.
Zfish   122 DDPPLFPNENRVTALT-QMESACV-SIHEALKSVMDYQTHFRLREAQGRSRAEDLNSRVAFWSVG 184

  Fly   208 QIVVILITCSVQVFFVRKLFEVKSSSKSRI 237
            :.:::|:....||..:|..|..:.::.:|:
Zfish   185 EALILLVVSVSQVLLLRSFFSDRKTTTTRM 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 42/180 (23%)
tmed7NP_001300637.1 EMP24_GP25L 28..205 CDD:279450 46/195 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.