DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and CG31787

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster


Alignment Length:221 Identity:48/221 - (21%)
Similarity:95/221 - (42%) Gaps:18/221 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IALICCCLLIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVRGG 80
            |.|:...||:|:..:.  .:|..:.|...|       :||:::|::|.:.......:.:.|:.||
  Fly     8 IWLLQLLLLLDLKFSN--AEPHNKQLTVFA-------EAGRQECFYQPIATTENIKIDYQVIHGG 63

  Fly    81 DGMA--GFAVRNPAGEVVKPYQWQATADYTDQVSPGGYYSVCIDNQFSRFAGKLVNIYITVVKYD 143
            .|..  .|.:.:|:..::.....:....::.|.:..|.|..|.||..|.|..|:|:..:.|...|
  Fly    64 LGETHINFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPAD 128

  Fly   144 AWDKYAKEIEQLQLNMQNFTAT-------VGTVERNINDMMGYQAHSRHRESRDYALLLDNNAYI 201
            ..::..:::.|..|...:|...       ||.:..|:......|...|..|:||..:.....:.:
  Fly   129 REERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMV 193

  Fly   202 QTFSISQIVVILITCSVQVFFVRKLF 227
            ..:|.:|.:.::....:||..||.:|
  Fly   194 NKWSWAQFLSMIFVGFLQVLMVRSIF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 40/190 (21%)
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 42/197 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454838
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D501818at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.