DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and Tmed6

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001099653.1 Gene:Tmed6 / 291991 RGDID:1305260 Length:238 Species:Rattus norvegicus


Alignment Length:243 Identity:55/243 - (22%)
Similarity:110/243 - (45%) Gaps:32/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVLPIALICCCLLIDVTSAQEAQ---------QPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAG 67
            |:|...|:...|   ||||:..:         ||....  |...|:.:.:..|..:|:.|:....
  Rat     4 LLLEAGLVVLSL---VTSAKSQRTDPLHGSKDQPLLRG--ADRHDFAIVVHPGNTECFWQFADQM 63

  Fly    68 ATFYVSFSVVR----GGDGMAGFAVRNPAGEVVKPYQWQATADYTDQVS----PGGYYSVCIDNQ 124
            ...|.|:.|.|    ..|.........|.|.::...|     |...|::    ..|:|.:|:.|:
  Rat    64 GYLYFSYEVQRTLGMSHDRHIVATAHTPQGFLIDTSQ-----DVRGQINFATQETGFYQLCLKNE 123

  Fly   125 FSRFAGKLVNIYITV-VKYDAWDKYAKEIEQLQLN--MQNFTATVGTVERNINDMMGYQAHSRHR 186
            .:||:.  :.:|:.. |.|:..:...|:.::.|||  :.....:...|:.::..|..:...:|.|
  Rat   124 QNRFSS--IQVYLNFGVFYEGPEMDHKQSQRKQLNDTLDAIEDSTRRVQNHVFHMWRFYNSARMR 186

  Fly   187 ESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVKSSSK 234
            :..|:.||..|.:|:..:|.:|.:.|:::..:|::|:::||.:.:.:|
  Rat   187 KVADFFLLQSNYSYVNWWSTAQSLAIVLSGVLQLYFLKRLFTISTDTK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 42/191 (22%)
Tmed6NP_001099653.1 EMP24_GP25L 43..227 CDD:395878 41/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45744
OrthoDB 1 1.010 - - D1262544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109201
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.