DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and SPAC17A5.08

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001342850.1 Gene:SPAC17A5.08 / 2542439 PomBaseID:SPAC17A5.08 Length:210 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:44/195 - (22%)
Similarity:88/195 - (45%) Gaps:18/195 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AVAMDYKVHIDAGKEDCYH-QYVKAGATFYVSFSVVRGGDGMAGFAVRNPAGEVVKPYQWQATAD 106
            |.|::....::..::.||: .....|...:.:::|..||.....:.::.|:.:.|...:.:..||
pombe    18 ASAIELTFKLENQEKQCYYLDSFHTGEKTHFTYAVQSGGSFDVDYMIKAPSQKTVALGKKRRQAD 82

  Fly   107 YTDQVSPGGYYSVCIDNQFSRFAGKLVNIYITV--------VKYDAWDKYAKEIEQLQLNMQNFT 163
            ....:...|.|..|.||..|.|..|:|.:.||:        :..|....|.|:      :||:..
pombe    83 VFFTLEEKGEYEFCFDNHMSTFTDKIVTMEITMENELSLPALTRDEAKDYKKD------SMQSTV 141

  Fly   164 ATVGTVERNINDMMGYQAHSRHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFE 228
            ..:.|....|:.:..|   .:.||.|:|:.:....|.|..||:::.::::...::|||.|:..|:
pombe   142 LEISTALSEIDRVQNY---FKTREHRNYSTVKSTQARIFWFSLAESIMVVALSALQVFIVKTFFK 203

  Fly   229  228
            pombe   204  203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 41/189 (22%)
SPAC17A5.08NP_001342850.1 EMP24_GP25L 22..203 CDD:307313 41/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.