DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and emp24

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_588020.1 Gene:emp24 / 2539350 PomBaseID:SPCC24B10.17 Length:199 Species:Schizosaccharomyces pombe


Alignment Length:209 Identity:45/209 - (21%)
Similarity:86/209 - (41%) Gaps:50/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVRGGDGMAGFAVRNPAGEVVKPYQWQATADY 107
            :|...:.:.:...:.:|:::.::......|::....|||.:...::.||||:::......:.|.|
pombe    17 SVVFGHGITLKPHQRECFYENLRNNDQMSVTYQTNVGGDQLVSMSIYNPAGQIMHQEVPNSMAQY 81

  Fly   108 TDQVSPGGYYSVCIDNQFSRFAGKLVNIYITVVKYDAWDKYAKEI------------EQLQLNMQ 160
            :..|...|.|..|..|                   ||.|..:||:            |.|..|  
pombe    82 SFTVKNPGKYMYCFYN-------------------DALDGESKEVLFNVHGVIYISDEDLDAN-- 125

  Fly   161 NFTATVGTVERNINDMMGYQAHSR---------HRESRDYALLLDNNAYIQTFSISQIVVILITC 216
              ...:|.| |.::|.:....|.:         ||.:.:     ..|..::.:||.|.|:::..|
pombe   126 --NPLLGKV-RQLHDTISKVKHEQEYFVARERIHRNTAE-----STNDRVKWWSILQTVILVSVC 182

  Fly   217 SVQVFFVRKLFEVK 230
            ..|:|::::|||||
pombe   183 VFQIFYLKRLFEVK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 40/201 (20%)
emp24NP_588020.1 EMP24_GP25L 21..194 CDD:279450 40/201 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.