DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and TMED6

DIOPT Version :9

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_653277.2 Gene:TMED6 / 146456 HGNCID:28331 Length:240 Species:Homo sapiens


Alignment Length:227 Identity:60/227 - (26%)
Similarity:108/227 - (47%) Gaps:23/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VTSAQ---------EAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVR---- 78
            ||||:         ...||.:..  |...|:.:.|..|..:|:.|:......||.|:.|.|    
Human    16 VTSARSQKTEPLSGSGDQPLFRG--ADRYDFAIMIPPGGTECFWQFAHQTGYFYFSYEVQRTVGM 78

  Fly    79 GGDGMAGFAVRNPAGEVVKPYQW-QATADYTDQVSPGGYYSVCIDNQFSRFAGKLVNIYITV-VK 141
            ..|........||.|.::...|. :...:::.|.:  |:|.:|:.||.:.|..  |.:|:.. |.
Human    79 SHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQET--GFYQLCLSNQHNHFGS--VQVYLNFGVF 139

  Fly   142 YDAWDKYAKEIEQLQLNMQNFTATVGT--VERNINDMMGYQAHSRHRESRDYALLLDNNAYIQTF 204
            |:..:...|:.|:.|||........||  |:.||..|..|...:|.|:..|:.|:..|..|:..:
Human   140 YEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWW 204

  Fly   205 SISQIVVILITCSVQVFFVRKLFEVKSSSKSR 236
            |.:|.:||:::..:|::|:::||.|.:::.::
Human   205 STAQSLVIILSGILQLYFLKRLFNVPTTTDTK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 51/188 (27%)
TMED6NP_653277.2 EMP24_GP25L 43..228 CDD:279450 51/188 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156473
Domainoid 1 1.000 69 1.000 Domainoid score I9693
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5276
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45744
OrthoDB 1 1.010 - - D1262544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto90385
orthoMCL 1 0.900 - - OOG6_109201
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7267
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.