DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Prss46

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_898926.2 Gene:Prss46 / 74306 MGIID:1921556 Length:314 Species:Mus musculus


Alignment Length:263 Identity:85/263 - (32%)
Similarity:138/263 - (52%) Gaps:25/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLW 80
            ||...:.:::||.|.:..:.|:||.:|  |.|.    .:|.|:::.:.||:|||||||..| |..
Mouse    36 GQTNITCKVVNGKAVEVGKWPWQVSIL--FLGM----YICSGSLIHHHWILTAAHCLQRSK-NPA 93

  Fly    81 KVLIHVGKVKSFDD---KEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSA 142
            |..:.|| |::..|   .|::|.|  .::|:.|..: :::|||::||...:|::..:||..|||.
Mouse    94 KYTVKVG-VQTLPDNSTSELLVTR--IVIHENFINR-MSDDIAILKLKYPVTWSPLVQPICLPSF 154

  Fly   143 K-KTYTGRKAIISGWGLTTKQ----LPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFI 202
            . |...|....:.||||...:    .|..| |.:...|::|:.|..::...|....||.:.|..:
Mouse   155 NLKPSIGTMCWVVGWGLEKAEGHPKTPYSV-QGLAVRIVNNEICNHRYQFLLLKNQKKFIGNDML 218

  Fly   203 CIDSKKGLPCRGDSGGPMVLDDGSRTLV--GIVSHGFDGEC-KLKLPDVSTRVSSYLKWIKYYSG 264
            |..|:.||....|:.|..::...::|.|  |:||..||  | :.:.|.|.|..|.:.:|||...|
Mouse   219 CTSSEWGLDTCQDTSGSSLVCQMNKTWVQMGVVSWNFD--CGRRQFPSVYTSTSHFTQWIKRQIG 281

  Fly   265 GLK 267
            .||
Mouse   282 DLK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 77/246 (31%)
Tryp_SPc 24..260 CDD:238113 78/246 (32%)
Prss46NP_898926.2 Tryp_SPc 43..276 CDD:214473 77/246 (31%)
Tryp_SPc 44..279 CDD:238113 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.