DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and C1S

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001725.1 Gene:C1S / 716 HGNCID:1247 Length:688 Species:Homo sapiens


Alignment Length:252 Identity:71/252 - (28%)
Similarity:114/252 - (45%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQ---DPKSNLWKVLI 84
            ||:.|:.|..|..|:||    :|    |.| ..||.:::..|::||||.::   :|...:....:
Human   437 RIIGGSDADIKNFPWQV----FF----DNP-WAGGALINEYWVLTAAHVVEGNREPTMYVGSTSV 492

  Fly    85 ---HVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTY 146
               .:.|.|....:.:.::..:.::.....|....|||||::|...:.....:.|..||.....|
Human   493 QTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDY 557

  Fly   147 T---GRKAIISGWGLTTKQLPSQVLQYIRAPIISNKEC-ERQWNKQLGGKSKKVVHNGFICIDSK 207
            .   |...:|||||.|.|:..:..|:..|.|:...::| |.:..|........|.....||...:
Human   558 NLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGE 622

  Fly   208 KGL-PCRGDSGGPM-VLDDGSRT---LVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259
            ||: .|:|||||.. |.|...:|   ..|:||.|  .:|...  .:.|||.:|:.||
Human   623 KGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWG--PQCGTY--GLYTRVKNYVDWI 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 69/250 (28%)
Tryp_SPc 24..260 CDD:238113 70/251 (28%)
C1SNP_001725.1 CUB 18..129 CDD:238001
FXa_inhibition 143..171 CDD:405372
CUB 175..287 CDD:395345
CCP 294..355 CDD:153056
Sushi 359..421 CDD:395037
Tryp_SPc 438..678 CDD:238113 70/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.