DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Prss41

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:264 Identity:78/264 - (29%)
Similarity:130/264 - (49%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQ---DP--------- 75
            ||:.|..:...:.|:|..|      ...:.:.|||::||.||::|||||.:   ||         
Mouse    83 RIVGGIESMQGRWPWQASL------RLKKSHRCGGSLLSRRWVLTAAHCFRKYLDPEKWTVQLGQ 141

  Fly    76 ---KSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPA 137
               |.:.|....:.|:.:.   |:|:||.         :.|..::|:||::|...:|:||.|||.
Mouse   142 LTSKPSYWNRKAYSGRYRV---KDIIVNS---------EDKLKSHDLALLRLASSVTYNKDIQPV 194

  Fly   138 KL-PSAKKTYTGR---KAIISGWGLTTKQL----PSQVLQYIRAPIISNKECERQWNKQLGGKSK 194
            .: ||   |:|.:   :..::|||:..:.|    |...|:.::..|::|..|:..:  ::.....
Mouse   195 CVQPS---TFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELF--EIFSLHH 254

  Fly   195 KVVHNGFICIDSKKGL--PCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYL 256
            .:..:.| |..::.|.  .|.||||||:|.: ||....:||||.|. |..:..||.:.|.||.|.
Mouse   255 LITKDVF-CAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSWGI-GCGRPNLPGIYTNVSHYY 317

  Fly   257 KWIK 260
            .||:
Mouse   318 NWIE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 76/261 (29%)
Tryp_SPc 24..260 CDD:238113 76/261 (29%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.