DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Prss22

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:260 Identity:77/260 - (29%)
Similarity:130/260 - (50%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQD--PKSNLWKVLIH 85
            ||:.|..:...|.|:.|.:|      |:..:.|.|::|:|||::|||||.:.  .|.:|:.||:.
Mouse   107 RIVGGEDSMDAQWPWIVSIL------KNGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLG 165

  Fly    86 VGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTN-DIALIKLPKKLTFNKYIQPAKLPSAK-----K 144
            ..|:.|...:...|..::.:.|.::..|..|: ||||::|...:.|::.|.|..||.:.     |
Mouse   166 AWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPK 230

  Fly   145 TYTGRKAIISGWGLTTKQLP---SQVLQYIRAPIISNKECER-QWNKQLGGKSKKVVHNGFICID 205
            |    ...|:|||.....:|   .|.||.::.|||.::.|:. .|.    |..::.:..|.:|..
Mouse   231 T----DCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWR----GAGQEAITEGMLCAG 287

  Fly   206 SKKGL--PCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSGGLK 267
            ..:|.  .|.||||||::.. |....|.||:|.| :|..:...|.|.|.:.::..|::....|::
Mouse   288 YLEGERDACLGDSGGPLMCQVDDHWLLTGIISWG-EGCAERNRPGVYTSLLAHRSWVQRIVQGVQ 351

  Fly   268  267
            Mouse   352  351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 75/250 (30%)
Tryp_SPc 24..260 CDD:238113 75/250 (30%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.