DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Cela3b

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_080695.1 Gene:Cela3b / 67868 MGIID:1915118 Length:269 Species:Mus musculus


Alignment Length:273 Identity:89/273 - (32%)
Similarity:136/273 - (49%) Gaps:27/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ILQLVLIVQFSLVFGQ--ETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRW 64
            :|..:|:|..:...||  ...|.|::||..|.....|:||.|....:||..  :.|||::::..|
Mouse     4 LLSSLLLVALASGCGQPSHNPSSRVVNGEEAVPHSWPWQVSLQYEKDGSFH--HTCGGSLITPDW 66

  Fly    65 IITAAHCLQDPKSNLWKVLI--HVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVT--NDIALIKLP 125
            ::||.||:.  .|..::|::  |...|:...::.|.:|.....||.|::...|:  |||||:||.
Mouse    67 VLTAGHCIS--TSRTYQVVLGEHERGVEEGQEQVIPINAGDLFVHPKWNSMCVSCGNDIALVKLS 129

  Fly   126 KKLTFNKYIQPAKLPSAKKTY-TGRKAIISGWG--LTTKQLPSQVLQYIRAPIISNKECERQWNK 187
            :.......:|.|.||.|.:.. .|....|||||  .|...||.: ||....|::..:.|.| || 
Mouse   130 RSAQLGDAVQLACLPPAGEILPNGAPCYISGWGRLSTNGPLPDK-LQQALLPVVDYEHCSR-WN- 191

  Fly   188 QLGGKSKKVVHNGFICI--DSKKGLPCRGDSGGPM--VLDDGSRTLVGIVSHGFDGECK-LKLPD 247
             ..|.|.|..   .:|.  |.:.|  |.||||||:  ..|:|:..:.|:.|......|. |:.|.
Mouse   192 -WWGLSVKTT---MVCAGGDIQSG--CNGDSGGPLNCPADNGTWQVHGVTSFVSSLGCNTLRKPT 250

  Fly   248 VSTRVSSYLKWIK 260
            |.||||:::.||:
Mouse   251 VFTRVSAFIDWIE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 81/247 (33%)
Tryp_SPc 24..260 CDD:238113 81/247 (33%)
Cela3bNP_080695.1 Tryp_SPc 27..262 CDD:214473 81/247 (33%)
Tryp_SPc 28..265 CDD:238113 82/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.